Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

Application

Immunoblotting (1:1000, chemiluminescence) r>Immunoprecipitation (1:100)

General description

Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.

Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.

Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.

Immunogen

a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Human

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Other Notes

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.

Maines, M.D. 1988 FASEB J.2, 2557.Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Packaging

100 µL in Plastic ampoule

Physical form

In PBS, 50% glycerol, pH 7.2.

Reconstitution

Following initial thaw, aliquot and freeze (-20°C).

Warning

Toxicity: Standard Handling (A)